IGF-1 DES 1mg
$99.99
-
Description
This product is being sold as a *Research Chemical and Bacteriostatic Water required.
IGF-1 DES 1mg
| Application | A truncated version of IGF-1 in which the tripeptide Gly-Pro-Glu is absent from the N-terminus end of the protein. |
| CAS | 112603-35-7 |
| Molar Mass | 7365.4225/mol |
| Chemical Formula | C319H495N91O96S7 |
| Amino Acid Sequence | TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKAAKSA |
| Synonyms | Insulin-like growth factor 1, des-(1-3)-, Des(1-3) IGF-1, 4-70-insulin-like growth factor 1 |
| Storage | Store in refrigerator at 4°C, tightly sealed, away from heat, light and moisture. |
| Solubility | Soluble in water |
| Organoleptic Profile | Fine white powder in 3mL glass aliquot |
| Composition | Each aliquot contains IGF-1 DES 1mg |
| Specification | IGF-1 DES content (per aliquot): IGF-1 DES 1mg |
| Terms | This material is sold for laboratory research use only. Terms of sale apply. Not for human consumption, nor medical, veterinary, or household uses. Please click the word Research Chemical to better understand what they are. *RESEARCH CHEMICAL. You should also review our Terms & Conditions. |
DISCLAIMER
By purchasing from SAF Research you agree that you are purchasing Research Chemicals. If you were looking for prescription medications intended for human use rather than a Research Chemical which is not for use in humans then please visit our sister company Swole Alternative Medicine here. We do telemedicine nationwide and offer multiple body optimization treatments. If you were looking for dietary supplements which are intended for human use rather than a Research Chemical which is not for use in humans then please visit our sister company Swole AF Nutrition here.
SAF Research products are furnished for LABORATORY RESEARCH USE ONLY. This product should only be handled by qualified, and licensed professionals. The product may not be used as a drug, agricultural or pesticidal product, food additive or household chemical – and may not be misbranded as such. All information on this website is available for educational purposes only. Bodily introduction of any kind into humans and/or animals is strictly forbidden by law.
*Research Chemicals ARE NOT DIETARY SUPPLEMENTS THEY ARE *RESEARCH CHEMICALS.
*Research chemicals are chemical substances used by scientists for medical and scientific research purposes. One characteristic of a research chemical is that it is for laboratory research use only; a research chemical is not intended for human or veterinary use. This distinction is required on the labels of research chemicals, and is what exempts them from regulation under parts 100-740 in Title 21 of the Code of Federal Regulations (21CFR).
Disclaimer: All references to “research subjects” or “test subjects” or and reference to “research” throughout this article refer to research conducted on non human non veterinary research subjects such as rats and mice. If we find that your intent is to use them outside of a legal manner we will no longer sell to you. To purchase Research Subjects visit The Jackson Laboratory.
